PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0534s0080.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 509aa    MW: 56838.7 Da    PI: 7.5519
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0534s0080.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM146.91e-451062312128
                     NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             ppGfrF P+d+elv +yL+kkv+g +l+  + i +v +y+++P+ L  ++k+ +ekewyfF++rd+ky++g+r+nra++ gyWkatg
  SapurV1A.0534s0080.1.p 106 PPGFRFCPHDHELVLYYLTKKVRGLPLPR-NKIVDVILYQYDPEYLADRYKHfGEKEWYFFTPRDRKYKNGSRPNRAANGGYWKATG 191
                             9**************************99.77**************9544444999******************************* PP

                     NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              dk+++  ++++vg +k Lv+y+g+apkg kt+W+mhe+r+
  SapurV1A.0534s0080.1.p 192 ADKNIIY-NQAVVGYRKALVYYTGKAPKGDKTNWIMHEFRV 231
                             *******.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-54103258IPR003441NAC domain
PROSITE profilePS5100553.247105258IPR003441NAC domain
PfamPF023652.6E-24106231IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MSSLEENSSE SPTMEFTEES MPEVHHSPTT PIAPNIPSNS PASPTQIPIT STSSPPPPAP  60
VPHPPSAIAS PSMVLQPPPP LTLAAAPAPP RFSNDRDNDR YFKSFPPGFR FCPHDHELVL  120
YYLTKKVRGL PLPRNKIVDV ILYQYDPEYL ADRYKHFGEK EWYFFTPRDR KYKNGSRPNR  180
AANGGYWKAT GADKNIIYNQ AVVGYRKALV YYTGKAPKGD KTNWIMHEFR VNDPLPQVRN  240
HRDEMRLDDW VLCRIYKKHE KRNNVRNGQR NEECSDVSNE QRNEEHSSGS LDEIGEDYIH  300
DHNSNDLAAM GADYAGEIYD MGAGSLENAL PVYNGLSQQP AAPRGFSDSF NFSTAPACHS  360
RTLRDTQVPN LAETFGNPAP MFPVNPDNWP YRQNGYPDEF LNLTHWSQVN IPGQFFDLHS  420
VKPTYLPRNP APLVNLLPTG TVLPAHGLPY LNTAPPGGRL PPINTARPAG RLPPTNTALL  480
TRRHPANIQP ASLTSVDAKL TGHPPRHL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B4e-5410425916166NAC domain-containing protein 19
4dul_A4e-5410425916166NAC domain-containing protein 19
1ut7_B4e-5410425916166NO APICAL MERISTEM PROTEIN
1ut7_A4e-5410425916166NO APICAL MERISTEM PROTEIN
1ut4_B4e-5410425916166NO APICAL MERISTEM PROTEIN
1ut4_A4e-5410425916166NO APICAL MERISTEM PROTEIN
3swp_D4e-5410425919169NAC domain-containing protein 19
3swp_C4e-5410425919169NAC domain-containing protein 19
3swp_B4e-5410425919169NAC domain-containing protein 19
3swp_A4e-5410425919169NAC domain-containing protein 19
3swm_D4e-5410425919169NAC domain-containing protein 19
3swm_C4e-5410425919169NAC domain-containing protein 19
3swm_B4e-5410425919169NAC domain-containing protein 19
3swm_A4e-5410425919169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011025641.10.0PREDICTED: uncharacterized protein LOC105126470
RefseqXP_011032281.10.0PREDICTED: uncharacterized protein LOC105131144
TrEMBLB9HNX90.0B9HNX9_POPTR; Uncharacterized protein
STRINGPOPTR_0009s05690.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101121642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.12e-57NAC domain containing protein 32